PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00001175-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 196aa    MW: 22072.6 Da    PI: 6.1508
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00001175-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.31.1e-151254143
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43
                        +g+WT+ Ed+ll d+v+++G+g+W+++a++ g++R +k+c++r
  WALNUT_00001175-RA 12 KGPWTPSEDKLLCDYVNLYGKGRWSSVAKCTGLNRNGKSCRLR 54
                        79***************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-15654IPR009057Homeodomain-like
PROSITE profilePS5129414.04763IPR017930Myb domain
SuperFamilySSF466891.79E-12854IPR009057Homeodomain-like
SMARTSM007172.9E-91161IPR001005SANT/Myb domain
PfamPF002491.3E-131254IPR001005SANT/Myb domain
CDDcd001671.42E-101454No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MGSGIQEQGW TKGPWTPSED KLLCDYVNLY GKGRWSSVAK CTGLNRNGKS CRLRSPEKKE  60
KGTKAIIPKQ KQPPQTQEQL PQENDMIKRA ISCGNRTPSD HHEQITTESQ GGKEMFFMHH  120
PTNLEDQCLP VTCQDVASWL DTIREEDLCG GPKNLDNHPK GVMDDHHDQA TAAGFSCGRV  180
NSIDYFYNED YIFLEG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24310.12e-19myb domain protein 305